2.50 Rating by CuteStat

It is a domain having xyz extension. It has a global traffic rank of #9619539 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, eba45owpdf.xyz is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 88
Daily Pageviews: 176

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 9,619,539
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

162.213.253.37

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Namecheap Parking Page

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.213.253.37)

Home - Setia Abadi Trans

- setia-abadi.com
11,218,006 $ 8.95


Goodhue Family Dental Review

- goodhuefamilydental.com
Not Applicable $ 8.95

Peace Ben Williams Blog – My WordPress Blog

- peacebenwilliams.com
3,738,396 $ 240.00

Gratitude Campaign – The Campaign Of Gratitude

- gratitudecampaign.org
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
date: Wed, 21 Oct 2020 21:36:43 GMT
server: Apache
accept-ranges: none
vary: Accept-Encoding
content-encoding: gzip
content-length: 1316
content-type: text/html

Domain Nameserver Information

Host IP Address Country
dns1.namecheaphosting.com 156.154.132.200 United States of America United States of America
dns2.namecheaphosting.com 156.154.133.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
eba45owpdf.xyz A 1199 IP: 162.213.253.37
eba45owpdf.xyz NS 1800000 Target: dns1.namecheaphosting.com
eba45owpdf.xyz NS 1800000 Target: dns2.namecheaphosting.com
eba45owpdf.xyz SOA 1800000 MNAME: dns1.namecheaphosting.com
RNAME: cpanel.tech.namecheap.com
Serial: 1603220300
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
eba45owpdf.xyz MX 1200 Target: mail.eba45owpdf.xyz
eba45owpdf.xyz TXT 1200 TXT: v=spf1 +a +mx +ip4:162.213.253.32
+ip4:162.213.253.52
include:spf.web-hosting.com ~all

Similarly Ranked Websites

Home Page

- boxfordhistoricalsociety.com
9,619,560 $ 8.95

Campus Connect

- campusconnect.cc
9,619,584 $ 8.95

403 Forbidden

- bucievola.com
9,619,596 $ 240.00

404 Not Found.

- evhanimlarindanyemektarifleri.com
9,619,613 $ 240.00

403 Forbidden

- repairgreatlyfreetheproduct.vip
9,619,634 $ 240.00